PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00019582-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family FAR1
Protein Properties Length: 479aa    MW: 54627.5 Da    PI: 7.2109
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00019582-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR152.22e-1664134173
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekd 73 
                            +fY +Y+k++GFs+r+sks++  + g+ ++r f+Cs egk++++k++    ++ r+etr gC+ak+kv+ +++
  SMil_00019582-RA_Salv  64 EFYLKYSKRMGFSIRRSKSHND-KFGKLVDRIFCCSAEGKKTNDKRE-IYVKKARPETRFGCQAKMKVSSRET 134
                            6****************99988.6667****************9999.99999***************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-1264135IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MDSGCTSSRR LSFEDINERN HDCDISDVVD DNNMNQSVNF MSLNNEEDKP KIGMSFDTED  60
DAYEFYLKYS KRMGFSIRRS KSHNDKFGKL VDRIFCCSAE GKKTNDKREI YVKKARPETR  120
FGCQAKMKVS SRETGMLLED RRYEEVKADF RANTSLPCLS YPVEILKHAV SIYTPEVYKI  180
FEQEWYKSHD SSLECFENGE LLASLKVFGM HNIKKIPNEY ILKRWTRKAK IGFSGDANIN  240
MSEMDPKLLQ NIRYKELCGL YVQLVTKASE NEDTYRIVKD GILKMFDMVD GDGELEQRTN  300
CRNLSLNADE LQITLGAKGI KSKNKTTSSK RLKSGLEKSK GKRKASRKKG QPLTNSTTSP  360
PLLSTNLEGV EENMTTISSV SDIPYQRLNT IEEFGTSSNQ QNFGGMPFSM NMTNLLLAQQ  420
PLNFDYLGAN NLQERNSLNK EAYLGDVNHG ERYESPASDH RVSHSTLEEL NPENVSHLG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1337348KSKGKRKASRKK
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1523422
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.25e-11FAR1 family protein